No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Brand: | Abnova |
| Reference: | H00057761-M03 |
| Product name: | TRIB3 monoclonal antibody (M03), clone 1H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIB3. |
| Clone: | 1H2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 57761 |
| Gene name: | TRIB3 |
| Gene alias: | C20orf97|NIPK|SINK|SKIP3|TRB3 |
| Gene description: | tribbles homolog 3 (Drosophila) |
| Genbank accession: | BC027484 |
| Immunogen: | TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH |
| Protein accession: | AAH27484 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to TRIB3 on A-431 cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |