| Brand: | Abnova |
| Reference: | H00057715-M01 |
| Product name: | SEMA4G monoclonal antibody (M01), clone 3F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SEMA4G. |
| Clone: | 3F2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57715 |
| Gene name: | SEMA4G |
| Gene alias: | FLJ20590|KIAA1619|MGC102867 |
| Gene description: | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G |
| Genbank accession: | NM_017893 |
| Immunogen: | SEMA4G (NP_060363, 24 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTEC |
| Protein accession: | NP_060363 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |