DDX55 MaxPab mouse polyclonal antibody (B01) View larger

DDX55 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDX55 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DDX55 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00057696-B01
Product name: DDX55 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DDX55 protein.
Gene id: 57696
Gene name: DDX55
Gene alias: FLJ16577|KIAA1595|MGC33209
Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 55
Genbank accession: BC035911
Immunogen: DDX55 (AAH35911, 1 a.a. ~ 207 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKPQRNTADLLPKLKSMALADRAVFEKGMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAKKEKKKKMNEKRKREEGSDIEDEDMEELLNDTRLLKKLKKGKITEEEFEKGLLTTGKRTIKTVDLGISDLEDDC
Protein accession: AAH35911
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057696-B01-13-15-1.jpg
Application image note: Western Blot analysis of DDX55 expression in transfected 293T cell line (H00057696-T01) by DDX55 MaxPab polyclonal antibody.

Lane 1: DDX55 transfected lysate(22.77 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DDX55 MaxPab mouse polyclonal antibody (B01) now

Add to cart