| Brand: | Abnova |
| Reference: | H00057680-M11A |
| Product name: | CHD8 monoclonal antibody (M11A), clone 2C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CHD8. |
| Clone: | 2C8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57680 |
| Gene name: | CHD8 |
| Gene alias: | DKFZp686N17164|HELSNF1|KIAA1564 |
| Gene description: | chromodomain helicase DNA binding protein 8 |
| Genbank accession: | NM_020920.3 |
| Immunogen: | CHD8 (NP_065971.2, 1980 a.a. ~ 2078 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYM |
| Protein accession: | NP_065971.2 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |