| Brand: | Abnova |
| Reference: | H00057680-A01 |
| Product name: | CHD8 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CHD8. |
| Gene id: | 57680 |
| Gene name: | CHD8 |
| Gene alias: | DKFZp686N17164|HELSNF1|KIAA1564 |
| Gene description: | chromodomain helicase DNA binding protein 8 |
| Genbank accession: | NM_020920 |
| Immunogen: | CHD8 (NP_065971, 1980 a.a. ~ 2078 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYM |
| Protein accession: | NP_065971 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | BioID identifies novel c-MYC interacting partners in cultured cells and xenograft tumors.Dingar D, Kalkat M, Chan PK, Srikumar T, Bailey SD, Tu WB, Coyaud E, Ponzielli R, Kolyar M, Jurisica I, Huang A, Lupien M, Penn LZ, Raught B. J Prot (2014), doi:10.1016/j.jprot.2014.09.029 |