Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GPAM polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about GPAM polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00057678-A01 |
| Product name: | GPAM polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GPAM. |
| Gene id: | 57678 |
| Gene name: | GPAM |
| Gene alias: | GPAT1|KIAA1560|MGC26846|RP11-426E5.2 |
| Gene description: | glycerol-3-phosphate acyltransferase, mitochondrial |
| Genbank accession: | NM_020918 |
| Immunogen: | GPAM (NP_065969, 749 a.a. ~ 828 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL |
| Protein accession: | NP_065969 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.91 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Molecular mechanism of age-specific hepatic lipid accumulation in PPARalpha (+/-):LDLR (+/-) mice, an obese mouse model.Li Y, Sugiyama E, Yokoyama S, Jiang L, Tanaka N, Aoyama T. Lipids. 2008 Apr;43(4):301-12. Epub 2008 Mar 12. |