View larger

POGK (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of POGK (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00057645-Q01
Product name:	POGK (Human) Recombinant Protein (Q01)
Product description:	Human POGK partial ORF ( NP_060012, 431 a.a. - 540 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	57645
Gene name:	POGK
Gene alias:	BASS2\|KIAA1513\|KIAA15131\|LST003
Gene description:	pogo transposable element with KRAB domain
Genbank accession:	NM_017542
Immunogen sequence/protein sequence:	MEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
Protein accession:	NP_060012
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice