| Brand: | Abnova |
| Reference: | H00057642-M01 |
| Product name: | KIAA1510 monoclonal antibody (M01), clone 1F5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant KIAA1510. |
| Clone: | 1F5 |
| Isotype: | IgG1 kappa |
| Gene id: | 57642 |
| Gene name: | COL20A1 |
| Gene alias: | KIAA1510|bA261N11.4 |
| Gene description: | collagen, type XX, alpha 1 |
| Genbank accession: | BC019637 |
| Immunogen: | KIAA1510 (AAH19637, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRGLEGTAGLPGPPGPRGFQGMAGARGTSGERGPPGTVGPTGLPGPKGERGEKGEPQSLATLYQLVSQACESAIQTHVSKFDSFHENTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGRGEPGAVGQMGSPGQQGASTQGLWE |
| Protein accession: | AAH19637 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged COL20A1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |