Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of VPS18 monoclonal antibody (M04), clone 4E9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,IP |
More info about VPS18 monoclonal antibody (M04), clone 4E9
| Brand: | Abnova |
| Reference: | H00057617-M04 |
| Product name: | VPS18 monoclonal antibody (M04), clone 4E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant VPS18. |
| Clone: | 4E9 |
| Isotype: | IgG3 Kappa |
| Gene id: | 57617 |
| Gene name: | VPS18 |
| Gene alias: | KIAA1475|PEP3 |
| Gene description: | vacuolar protein sorting 18 homolog (S. cerevisiae) |
| Genbank accession: | NM_020857 |
| Immunogen: | VPS18 (NP_065908, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV |
| Protein accession: | NP_065908 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of VPS18 transfected lysate using anti-VPS18 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with VPS18 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |