| Brand: | Abnova |
| Reference: | H00057617-M02 |
| Product name: | VPS18 monoclonal antibody (M02), clone 2G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant VPS18. |
| Clone: | 2G10 |
| Isotype: | IgG3 Kappa |
| Gene id: | 57617 |
| Gene name: | VPS18 |
| Gene alias: | KIAA1475|PEP3 |
| Gene description: | vacuolar protein sorting 18 homolog (S. cerevisiae) |
| Genbank accession: | NM_020857 |
| Immunogen: | VPS18 (NP_065908, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV |
| Protein accession: | NP_065908 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | VPS18 monoclonal antibody (M02), clone 2G10. Western Blot analysis of VPS18 expression in Raw 264.7. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The cellular factors Vps18 and Mon2 are required for efficient production of infectious HIV-1 particles.Tomita Y, Noda T, Fujii K, Watanabe T, Morikawa Y, Kawaoka Y. J Virol. 2011 Mar 30. [Epub ahead of print] |