PDP2 purified MaxPab mouse polyclonal antibody (B01P) View larger

PDP2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDP2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PDP2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00057546-B01P
Product name: PDP2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PDP2 protein.
Gene id: 57546
Gene name: PDP2
Gene alias: KIAA1348
Gene description: pyruvate dehydrogenase phosphatase isoenzyme 2
Genbank accession: NM_020786.1
Immunogen: PDP2 (NP_065837.1, 1 a.a. ~ 529 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
Protein accession: NP_065837.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057546-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PDP2 expression in transfected 293T cell line (H00057546-T01) by PDP2 MaxPab polyclonal antibody.

Lane 1: PDP2 transfected lysate(58.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PDP2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart