| Brand: | Abnova |
| Reference: | H00057537-M03 |
| Product name: | SORCS2 monoclonal antibody (M03), clone 1D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SORCS2. |
| Clone: | 1D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57537 |
| Gene name: | SORCS2 |
| Gene alias: | - |
| Gene description: | sortilin-related VPS10 domain containing receptor 2 |
| Genbank accession: | NM_020777.1 |
| Immunogen: | SORCS2 (NP_065828.1, 802 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI |
| Protein accession: | NP_065828.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SORCS2 monoclonal antibody (M03), clone 1D7. Western Blot analysis of SORCS2 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |