SORCS2 polyclonal antibody (A01) View larger

SORCS2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SORCS2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SORCS2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00057537-A01
Product name: SORCS2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SORCS2.
Gene id: 57537
Gene name: SORCS2
Gene alias: -
Gene description: sortilin-related VPS10 domain containing receptor 2
Genbank accession: NM_020777.1
Immunogen: SORCS2 (NP_065828.1, 802 a.a. ~ 900 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
Protein accession: NP_065828.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057537-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SORCS2 polyclonal antibody (A01) now

Add to cart