No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00057526-M04 |
Product name: | PCDH19 monoclonal antibody (M04), clone 2G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDH19. |
Clone: | 2G10 |
Isotype: | IgG2a Kappa |
Gene id: | 57526 |
Gene name: | PCDH19 |
Gene alias: | DKFZp686P1843|EFMR|KIAA1313 |
Gene description: | protocadherin 19 |
Genbank accession: | NM_020766 |
Immunogen: | PCDH19 (NP_065817, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR |
Protein accession: | NP_065817 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |