| Brand: | Abnova |
| Reference: | H00057522-M07 |
| Product name: | SRGAP1 monoclonal antibody (M07), clone 5D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SRGAP1. |
| Clone: | 5D10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57522 |
| Gene name: | SRGAP1 |
| Gene alias: | ARHGAP13|FLJ22166|KIAA1304 |
| Gene description: | SLIT-ROBO Rho GTPase activating protein 1 |
| Genbank accession: | NM_020762 |
| Immunogen: | SRGAP1 (NP_065813, 952 a.a. ~ 1050 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLDPETIAQDIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQL |
| Protein accession: | NP_065813 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | SRGAP1 monoclonal antibody (M07), clone 5D10. Western Blot analysis of SRGAP1 expression in NIH/3T3(Cat # L018V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mutations of the SLIT2âROBO2 pathway genes SLIT2 and SRGAP1 confer risk for congenital anomalies of the kidney and urinary tract.Hwang DY, Kohl S, Fan X, Vivante A, Chan S, Dworschak GC, Schulz J, van Eerde AM, Hilger AC, Gee HY, Pennimpede T, Herrmann BG, van de Hoek G, Renkema KY, Schell C, Huber TB, Reutter HM, Soliman NA, Stajic N, Bogdanovic R, Kehinde EO, Lifton RP, Tasic V, Lu W, Hildebrandt F. Hum Genet. 2015 May 31. [Epub ahead of print] |