Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RPTOR monoclonal antibody (M04), clone 3C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about RPTOR monoclonal antibody (M04), clone 3C2
| Brand: | Abnova |
| Reference: | H00057521-M04 |
| Product name: | RPTOR monoclonal antibody (M04), clone 3C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPTOR. |
| Clone: | 3C2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57521 |
| Gene name: | RPTOR |
| Gene alias: | KOG1|Mip1 |
| Gene description: | regulatory associated protein of MTOR, complex 1 |
| Genbank accession: | NM_020761 |
| Immunogen: | RPTOR (NP_065812.1, 1226 a.a. ~ 1335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR |
| Protein accession: | NP_065812.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |