Cart 110 Product Products 37 258,72 € (empty)
-
-
1 x Bax...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x MPP1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
1 x SLP-76...259,07 € -
-
-
-
-
-
-
1 x PDLIM5...259,07 € -
-
-
-
-
-
-
-
-
-
1 x MerTK/Tyro...259,07 € -
1 x MARCH3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-CR...259,07 € -
-
-
No products
To be determined Shipping
37 258,72 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 110 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 37 258,72 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 37 258,72 €
Data sheet of RPTOR purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about RPTOR purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00057521-B01P |
| Product name: | RPTOR purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human RPTOR protein. |
| Gene id: | 57521 |
| Gene name: | RPTOR |
| Gene alias: | KOG1|Mip1 |
| Gene description: | regulatory associated protein of MTOR, complex 1 |
| Genbank accession: | BC064515 |
| Immunogen: | RPTOR (AAH64515.1, 1 a.a. ~ 379 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW |
| Protein accession: | AAH64515.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of purified MaxPab antibody to RPTOR on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |