| Brand: | Abnova |
| Reference: | H00057504-M10 |
| Product name: | MTA3 monoclonal antibody (M10), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MTA3. |
| Clone: | 1F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57504 |
| Gene name: | MTA3 |
| Gene alias: | KIAA1266 |
| Gene description: | metastasis associated 1 family, member 3 |
| Genbank accession: | NM_020744 |
| Immunogen: | MTA3 (NP_065795, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS |
| Protein accession: | NP_065795 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |