Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARID1B monoclonal antibody (M02), clone 2F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about ARID1B monoclonal antibody (M02), clone 2F2
| Brand: | Abnova |
| Reference: | H00057492-M02 |
| Product name: | ARID1B monoclonal antibody (M02), clone 2F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARID1B. |
| Clone: | 2F2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 57492 |
| Gene name: | ARID1B |
| Gene alias: | 6A3-5|BAF250b|BRIGHT|DAN15|ELD/OSA1|KIAA1235|p250R |
| Gene description: | AT rich interactive domain 1B (SWI1-like) |
| Genbank accession: | NM_017519 |
| Immunogen: | ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR |
| Protein accession: | NP_059989 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Arid1b haploinsufficiency disrupts cortical interneuron development and mouse behavior.Jung EM, Moffat JJ, Liu J, Dravid SM, Gurumurthy CB, Kim WY. Nat Neurosci. 2017 Dec;20(12):1694-1707. doi: 10.1038/s41593-017-0013-0. Epub 2017 Nov 6. |