Brand: | Abnova |
Reference: | H00057492-A01 |
Product name: | ARID1B polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ARID1B. |
Gene id: | 57492 |
Gene name: | ARID1B |
Gene alias: | 6A3-5|BAF250b|BRIGHT|DAN15|ELD/OSA1|KIAA1235|p250R |
Gene description: | AT rich interactive domain 1B (SWI1-like) |
Genbank accession: | NM_017519 |
Immunogen: | ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR |
Protein accession: | NP_059989 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.78 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |