| Brand: | Abnova |
| Reference: | H00057491-A01 |
| Product name: | AHRR polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant AHRR. |
| Gene id: | 57491 |
| Gene name: | AHRR |
| Gene alias: | AHH|AHHR|KIAA1234|MGC167813|MGC176630|bHLHe77 |
| Gene description: | aryl-hydrocarbon receptor repressor |
| Genbank accession: | NM_020731 |
| Immunogen: | AHRR (NP_065782, 617 a.a. ~ 715 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP |
| Protein accession: | NP_065782 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Role of AHR, AHRR and ARNT in response to dioxin-like PCBs in Spaurus aurata.Calo M, Licata P, Bitto A, Cascio PL, Interdonato M, Altavilla D Environ Sci Pollut Res Int. 2014 Jul 26. |