| Brand: | Abnova |
| Reference: | H00057449-M01 |
| Product name: | PLEKHG5 monoclonal antibody (M01), clone 5A9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLEKHG5. |
| Clone: | 5A9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57449 |
| Gene name: | PLEKHG5 |
| Gene alias: | DSMA4|GEF720|KIAA0720|RP4-650H14.3 |
| Gene description: | pleckstrin homology domain containing, family G (with RhoGef domain) member 5 |
| Genbank accession: | NM_020631 |
| Immunogen: | PLEKHG5 (NP_065682, 896 a.a. ~ 995 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL |
| Protein accession: | NP_065682 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PLEKHG5 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Phosphorylation-mediated 14-3-3 Protein Binding Regulates the Function of the Rho-specific Guanine Nucleotide Exchange Factor (RhoGEF) Syx.Ngok SP, Geyer R, Kourtidis A, Storz P, Anastasiadis PZ J Biol Chem. 2013 Mar 1;288(9):6640-50. doi: 10.1074/jbc.M112.432682. Epub 2013 Jan 18. |