Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BIRC6 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about BIRC6 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00057448-A01 |
| Product name: | BIRC6 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BIRC6. |
| Gene id: | 57448 |
| Gene name: | BIRC6 |
| Gene alias: | APOLLON|BRUCE|FLJ13726|FLJ13786|KIAA1289 |
| Gene description: | baculoviral IAP repeat-containing 6 |
| Genbank accession: | NM_016252 |
| Immunogen: | BIRC6 (NP_057336, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RDGCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVT |
| Protein accession: | NP_057336 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |