| Brand: | Abnova |
| Reference: | H00057410-M02 |
| Product name: | SCYL1 monoclonal antibody (M02), clone 2E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SCYL1. |
| Clone: | 2E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57410 |
| Gene name: | SCYL1 |
| Gene alias: | GKLP|HT019|MGC78454|NKTL|NTKL|P105|TAPK|TEIF|TRAP |
| Gene description: | SCY1-like 1 (S. cerevisiae) |
| Genbank accession: | BC009967 |
| Immunogen: | SCYL1 (AAH09967, 373 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP |
| Protein accession: | AAH09967 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of Tyrosine-Phosphorylated Proteins Associated with Lung Cancer Metastasis using Label-Free Quantitative Analyses.Wu HY, Tseng VS, Chen LC, Chang HY, Chuang IC, Tsay YG, Liao PC. J Proteome Res. 2010 Jun 23. [Epub ahead of print] |