Brand: | Abnova |
Reference: | H00057369-M03 |
Product name: | GJD2 monoclonal antibody (M03), clone 5E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GJD2. |
Clone: | 5E5 |
Isotype: | IgG2a Kappa |
Gene id: | 57369 |
Gene name: | GJD2 |
Gene alias: | CX36|GJA9|MGC138315|MGC138319 |
Gene description: | gap junction protein, delta 2, 36kDa |
Genbank accession: | NM_020660 |
Immunogen: | GJD2 (NP_065711.1, 99 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR |
Protein accession: | NP_065711.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GJD2 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |