Brand: | Abnova |
Reference: | H00057348-M02 |
Product name: | TTYH1 monoclonal antibody (M02), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TTYH1. |
Clone: | 2G9 |
Isotype: | IgG2b Kappa |
Gene id: | 57348 |
Gene name: | TTYH1 |
Gene alias: | - |
Gene description: | tweety homolog 1 (Drosophila) |
Genbank accession: | NM_020659 |
Immunogen: | TTYH1 (NP_065710, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN |
Protein accession: | NP_065710 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |