No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA |
Brand: | Abnova |
Reference: | H00057337-M01 |
Product name: | SENP7 monoclonal antibody (M01), clone 2D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SENP7. |
Clone: | 2D4 |
Isotype: | IgG2a Kappa |
Gene id: | 57337 |
Gene name: | SENP7 |
Gene alias: | KIAA1707|MGC157730 |
Gene description: | SUMO1/sentrin specific peptidase 7 |
Genbank accession: | NM_020654 |
Immunogen: | SENP7 (NP_065705, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNKVISLDHKNKKHIRGCPVTSRSSPERIPRVILTNVLGTELG |
Protein accession: | NP_065705 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to SENP7 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |