ZNF287 monoclonal antibody (M08), clone 3A2 View larger

ZNF287 monoclonal antibody (M08), clone 3A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF287 monoclonal antibody (M08), clone 3A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ZNF287 monoclonal antibody (M08), clone 3A2

Brand: Abnova
Reference: H00057336-M08
Product name: ZNF287 monoclonal antibody (M08), clone 3A2
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF287.
Clone: 3A2
Isotype: IgG2a Kappa
Gene id: 57336
Gene name: ZNF287
Gene alias: MGC126536|MGC141923|ZKSCAN13
Gene description: zinc finger protein 287
Genbank accession: NM_020653
Immunogen: ZNF287 (NP_065704.1, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PEWETKAQACTPVEDMSKLTKEETHTIKLEDSYDYDDRLERRGKGGFWKIHTDERGFSLKSVLSQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDN
Protein accession: NP_065704.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057336-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057336-M08-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF287 is 0.1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF287 monoclonal antibody (M08), clone 3A2 now

Add to cart