Brand: | Abnova |
Reference: | H00057336-M08 |
Product name: | ZNF287 monoclonal antibody (M08), clone 3A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF287. |
Clone: | 3A2 |
Isotype: | IgG2a Kappa |
Gene id: | 57336 |
Gene name: | ZNF287 |
Gene alias: | MGC126536|MGC141923|ZKSCAN13 |
Gene description: | zinc finger protein 287 |
Genbank accession: | NM_020653 |
Immunogen: | ZNF287 (NP_065704.1, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PEWETKAQACTPVEDMSKLTKEETHTIKLEDSYDYDDRLERRGKGGFWKIHTDERGFSLKSVLSQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDN |
Protein accession: | NP_065704.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZNF287 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |