| Brand: | Abnova |
| Reference: | H00057326-M02 |
| Product name: | PBXIP1 monoclonal antibody (M02), clone 7E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PBXIP1. |
| Clone: | 7E1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 57326 |
| Gene name: | PBXIP1 |
| Gene alias: | HPIP |
| Gene description: | pre-B-cell leukemia homeobox interacting protein 1 |
| Genbank accession: | NM_020524 |
| Immunogen: | PBXIP1 (NP_065385.2, 480 a.a. ~ 578 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKEGKRQGPKEPPRKSGSFHSSGEKQKQPRWREGTKDSHDPLPSWAELL |
| Protein accession: | NP_065385.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PBXIP1 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | HPIP silencing inhibits TGF-β1-induced EMT in lung cancer cells.Shi S, Zhao J, Wang J, Mi D, Ma Z. Int J Mol Med. 2017 Feb;39(2):479-483. doi: 10.3892/ijmm.2017.2851. Epub 2017 Jan 5. |