Cart 1 Product Products 96,67 € (empty)
No products
To be determined Shipping
96,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 96,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 96,67 €
Data sheet of KIAA1199 monoclonal antibody (M01), clone 3C12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about KIAA1199 monoclonal antibody (M01), clone 3C12
| Brand: | Abnova |
| Reference: | H00057214-M01 |
| Product name: | KIAA1199 monoclonal antibody (M01), clone 3C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KIAA1199. |
| Clone: | 3C12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57214 |
| Gene name: | KIAA1199 |
| Gene alias: | TMEM2L |
| Gene description: | KIAA1199 |
| Genbank accession: | NM_018689 |
| Immunogen: | KIAA1199 (NP_061159.1, 880 a.a. ~ 979 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW |
| Protein accession: | NP_061159.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of KIAA1199 transfected lysate using anti-KIAA1199 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with KIAA1199 MaxPab rabbit polyclonal antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | KIAA1199 as a potential diagnostic biomarker of rheumatoid arthritis related to angiogenesis.Yang X, Qiu PC, Chen BB, Lin YY, Zhou ZH, Ge RS, Zou H, Wang JM, Wang JG. Arthritis Research & Therapy (2015) 17:140 |