Brand: | Abnova |
Reference: | H00057213-M01 |
Product name: | C13orf1 monoclonal antibody (M01), clone 2G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C13orf1. |
Clone: | 2G4 |
Isotype: | IgG1 Kappa |
Gene id: | 57213 |
Gene name: | C13orf1 |
Gene alias: | CLLD6 |
Gene description: | chromosome 13 open reading frame 1 |
Genbank accession: | NM_020456 |
Immunogen: | C13orf1 (NP_065189, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF |
Protein accession: | NP_065189 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | C13orf1 monoclonal antibody (M01), clone 2G4 Western Blot analysis of C13orf1 expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |