KIAA1191 monoclonal antibody (M01), clone 2F7 View larger

KIAA1191 monoclonal antibody (M01), clone 2F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIAA1191 monoclonal antibody (M01), clone 2F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about KIAA1191 monoclonal antibody (M01), clone 2F7

Brand: Abnova
Reference: H00057179-M01
Product name: KIAA1191 monoclonal antibody (M01), clone 2F7
Product description: Mouse monoclonal antibody raised against a full-length recombinant KIAA1191.
Clone: 2F7
Isotype: IgG2b Kappa
Gene id: 57179
Gene name: KIAA1191
Gene alias: FLJ21022|p60MONOX
Gene description: KIAA1191
Genbank accession: NM_020444.2
Immunogen: KIAA1191 (NP_065177.2, 1 a.a. ~ 305 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKVEEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGF
Protein accession: NP_065177.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057179-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.6 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00057179-M01-1-9-1.jpg
Application image note: KIAA1191 monoclonal antibody (M01), clone 2F7. Western Blot analysis of KIAA1191 expression in K-562.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KIAA1191 monoclonal antibody (M01), clone 2F7 now

Add to cart