Brand: | Abnova |
Reference: | H00057159-M02 |
Product name: | TRIM54 monoclonal antibody (M02), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM54. |
Clone: | 2G9 |
Isotype: | IgG2b Kappa |
Gene id: | 57159 |
Gene name: | TRIM54 |
Gene alias: | MURF|MURF-3|RNF30 |
Gene description: | tripartite motif-containing 54 |
Genbank accession: | NM_032546 |
Immunogen: | TRIM54 (NP_115935, 186 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PILASQNTKIIDSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERK |
Protein accession: | NP_115935 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |