Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLURP1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SLURP1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00057152-A01 |
| Product name: | SLURP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SLURP1. |
| Gene id: | 57152 |
| Gene name: | SLURP1 |
| Gene alias: | ANUP|ARS|ArsB|LY6LS|MDM |
| Gene description: | secreted LY6/PLAUR domain containing 1 |
| Genbank accession: | NM_020427 |
| Immunogen: | SLURP1 (NP_065160, 25 a.a. ~ 102 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE |
| Protein accession: | NP_065160 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.69 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | SLURP-1 Mutation Impaired T-Cell Activation in a Mal de Meleda Family.Tjiu JW, Lin PJ, Wu WH, Cheng YP, Chiu HC, Thong HY, Chiang BL, Yang WS, Jee SH. Br J Dermatol. 2010 Sep 21. doi: 10.1111/j.1365-2133.2010.10059.x. [Epub ahead of print] |