XPMC2H polyclonal antibody (A01) View larger

XPMC2H polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of XPMC2H polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about XPMC2H polyclonal antibody (A01)

Brand: Abnova
Reference: H00057109-A01
Product name: XPMC2H polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant XPMC2H.
Gene id: 57109
Gene name: REXO4
Gene alias: REX4|XPMC2|XPMC2H
Gene description: REX4, RNA exonuclease 4 homolog (S. cerevisiae)
Genbank accession: NM_020385
Immunogen: XPMC2H (NP_065118, 323 a.a. ~ 422 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA
Protein accession: NP_065118
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057109-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy XPMC2H polyclonal antibody (A01) now

Add to cart