PLSCR3 MaxPab rabbit polyclonal antibody (D01) View larger

PLSCR3 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLSCR3 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr,IP

More info about PLSCR3 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00057048-D01
Product name: PLSCR3 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human PLSCR3 protein.
Gene id: 57048
Gene name: PLSCR3
Gene alias: -
Gene description: phospholipid scramblase 3
Genbank accession: BC011735.2
Immunogen: PLSCR3 (AAH11735.1, 1 a.a. ~ 295 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS
Protein accession: AAH11735.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00057048-D01-2-A7-1.jpg
Application image note: PLSCR3 MaxPab rabbit polyclonal antibody. Western Blot analysis of PLSCR3 expression in human pancreas.
Applications: WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy PLSCR3 MaxPab rabbit polyclonal antibody (D01) now

Add to cart