| Brand: | Abnova |
| Reference: | H00057045-P01 |
| Product name: | TWSG1 (Human) Recombinant Protein (P01) |
| Product description: | Human TWSG1 full-length ORF ( AAH20490, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 57045 |
| Gene name: | TWSG1 |
| Gene alias: | TSG |
| Gene description: | twisted gastrulation homolog 1 (Drosophila) |
| Genbank accession: | BC020490 |
| Immunogen sequence/protein sequence: | MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF |
| Protein accession: | AAH20490 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | High levels of GDF15 in thalassemia suppress expression of the iron regulatory protein hepcidin.Tanno T, Bhanu NV, Oneal PA, Goh SH, Staker P, Lee YT, Moroney JW, Reed CH, Luban NL, Wang RH, Eling TE, Childs R, Ganz T, Leitman SF, Fucharoen S, Miller JL. Nat Med. 2007 Sep;13(9):1096-101. Epub 2007 Aug 26. |