Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TWSG1 monoclonal antibody (M07), clone 2F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about TWSG1 monoclonal antibody (M07), clone 2F3
| Brand: | Abnova |
| Reference: | H00057045-M07 |
| Product name: | TWSG1 monoclonal antibody (M07), clone 2F3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TWSG1. |
| Clone: | 2F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57045 |
| Gene name: | TWSG1 |
| Gene alias: | TSG |
| Gene description: | twisted gastrulation homolog 1 (Drosophila) |
| Genbank accession: | BC020490 |
| Immunogen: | TWSG1 (AAH20490, 1 a.a. ~ 223 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF |
| Protein accession: | AAH20490 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (50.05 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TWSG1 monoclonal antibody (M07), clone 2F3. Western Blot analysis of TWSG1 expression in human kidney. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Autosomal dominant mesomandibular fibro-osseous dysplasia: a self-resolving inherited fibro-osseous lesion of the jaws.Koutlas IG, Forsman CL, Kyrkanides S, Oetting WS, Petryk A. Front Physiol. 2012;3:458. doi: 10.3389/fphys.2012.00458. Epub 2012 Dec 6. |