No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00057019-M01 |
Product name: | CIAPIN1 monoclonal antibody (M01), clone 5G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CIAPIN1. |
Clone: | 5G8 |
Isotype: | IgG1 Lambda |
Gene id: | 57019 |
Gene name: | CIAPIN1 |
Gene alias: | 2810413N20Rik|Anamorsin|DRE2|PRO0915 |
Gene description: | cytokine induced apoptosis inhibitor 1 |
Genbank accession: | NM_020313 |
Immunogen: | CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA |
Protein accession: | NP_064709 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | CIAPIN1 monoclonal antibody (M01), clone 5G8 Western Blot analysis of CIAPIN1 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |