| Brand: | Abnova |
| Reference: | H00056997-M05A |
| Product name: | CABC1 monoclonal antibody (M05A), clone 8F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CABC1. |
| Clone: | 8F7 |
| Isotype: | IgM Kappa |
| Gene id: | 56997 |
| Gene name: | CABC1 |
| Gene alias: | ADCK3|ARCA2|COQ8|MGC4849|SCAR9 |
| Gene description: | chaperone, ABC1 activity of bc1 complex homolog (S. pombe) |
| Genbank accession: | BC005171 |
| Immunogen: | CABC1 (AAH05171, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD |
| Protein accession: | AAH05171 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CABC1 monoclonal antibody (M05A), clone 8F7 Western Blot analysis of CABC1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |