| Brand: | Abnova |
| Reference: | H00056995-M05 |
| Product name: | TULP4 monoclonal antibody (M05), clone 7B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TULP4. |
| Clone: | 7B7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 56995 |
| Gene name: | TULP4 |
| Gene alias: | KIAA1397|TUSP |
| Gene description: | tubby like protein 4 |
| Genbank accession: | NM_001007466 |
| Immunogen: | TULP4 (NP_001007467.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLAT |
| Protein accession: | NP_001007467.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TULP4 monoclonal antibody (M05), clone 7B7. Western Blot analysis of TULP4 expression in K-562. |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |