Login to display prices
Login to display prices
SMYD2 purified MaxPab mouse polyclonal antibody (B01P) View larger

SMYD2 purified MaxPab mouse polyclonal antibody (B01P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMYD2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Tr

More info about SMYD2 purified MaxPab mouse polyclonal antibody (B01P)

Product description: Mouse polyclonal antibody raised against a full-length human SMYD2 protein.
Gene id: 56950
Gene name: SMYD2
Gene alias: HSKM-B|KMT3C|MGC119305|ZMYND14
Gene description: SET and MYND domain containing 2
Genbank accession: NM_020197
Immunogen: SMYD2 (NP_064582.1, 1 a.a. ~ 433 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Protein accession: NP_064582.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Size: 50 ug
Shipping condition: Dry Ice

30 other products in the same category: