Login to display prices
Login to display prices
C11orf30 polyclonal antibody (A01) View larger

C11orf30 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C11orf30 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about C11orf30 polyclonal antibody (A01)

Product description: Mouse polyclonal antibody raised against a partial recombinant C11orf30.
Gene id: 56946
Gene name: C11orf30
Gene alias: EMSY|FLJ90741|GL002
Gene description: chromosome 11 open reading frame 30
Genbank accession: NM_020193
Immunogen: C11orf30 (NP_064578, 1081 a.a. ~ 1178 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATS
Protein accession: NP_064578
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Size: 50 uL
Shipping condition: Dry Ice

30 other products in the same category: