MRPS22 monoclonal antibody (M10), clone 1E1 View larger

MRPS22 monoclonal antibody (M10), clone 1E1

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS22 monoclonal antibody (M10), clone 1E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MRPS22 monoclonal antibody (M10), clone 1E1

Brand: Abnova
Reference: H00056945-M10
Product name: MRPS22 monoclonal antibody (M10), clone 1E1
Product description: Mouse monoclonal antibody raised against a full-length recombinant MRPS22.
Clone: 1E1
Isotype: IgG2a Kappa
Gene id: 56945
Gene name: MRPS22
Gene alias: C3orf5|COXPD5|GIBT|GK002|MRP-S22|RPMS22
Gene description: mitochondrial ribosomal protein S22
Genbank accession: BC009296
Immunogen: MRPS22 (AAH09296, 1 a.a. ~ 360 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
Protein accession: AAH09296
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056945-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (65.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056945-M10-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged MRPS22 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Related products: - C11orf30 monoclonal antibody (M01), clone 5D1
- XAB2 monoclonal antibody (M01), clone 1D1-1A9
- NT5M monoclonal antibody (M02), clone 3E2
- LHX9 monoclonal antibody (M01), clone 4C7
- LHX9 monoclonal antibody (M08), clone 1D8
Shipping condition: Dry Ice

Buy MRPS22 monoclonal antibody (M10), clone 1E1 now

Add to cart