Login to display prices
Login to display prices
MRPS22 monoclonal antibody (M10), clone 1E1 View larger

MRPS22 monoclonal antibody (M10), clone 1E1

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS22 monoclonal antibody (M10), clone 1E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MRPS22 monoclonal antibody (M10), clone 1E1

Product description: Mouse monoclonal antibody raised against a full-length recombinant MRPS22.
Clone: 1E1
Isotype: IgG2a Kappa
Gene id: 56945
Gene name: MRPS22
Gene alias: C3orf5|COXPD5|GIBT|GK002|MRP-S22|RPMS22
Gene description: mitochondrial ribosomal protein S22
Genbank accession: BC009296
Immunogen: MRPS22 (AAH09296, 1 a.a. ~ 360 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
Protein accession: AAH09296
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Size: 100 ug
Shipping condition: Dry Ice

30 other products in the same category: