Login to display prices
Login to display prices
DUSP22 (Human) Recombinant Protein (Q01) View larger

DUSP22 (Human) Recombinant Protein (Q01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP22 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about DUSP22 (Human) Recombinant Protein (Q01)

Product description: Human DUSP22 partial ORF ( NP_064570, 112 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 56940
Gene name: DUSP22
Gene alias: JKAP|JSP1|MKPX|VHX
Gene description: dual specificity phosphatase 22
Genbank accession: NM_020185
Immunogen sequence/protein sequence: EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Protein accession: NP_064570
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Size: 10 ug
Shipping condition: Dry Ice

30 other products in the same category: