DUSP22 (Human) Recombinant Protein (P01) View larger

DUSP22 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP22 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about DUSP22 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00056940-P01
Product name: DUSP22 (Human) Recombinant Protein (P01)
Product description: Human DUSP22 full-length ORF ( NP_064570.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 56940
Gene name: DUSP22
Gene alias: JKAP|JSP1|MKPX|VHX
Gene description: dual specificity phosphatase 22
Genbank accession: NM_020185.3
Immunogen sequence/protein sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Protein accession: NP_064570.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00056940-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - DUSP22 (Human) Recombinant Protein (Q01)
- OLFML3 (Human) Recombinant Protein (P01)
- MRPS22 (Human) Recombinant Protein (P01)
- MRPS22 (Human) Recombinant Protein (Q01)
- C11orf30 (Human) Recombinant Protein (Q01)
Shipping condition: Dry Ice

Buy DUSP22 (Human) Recombinant Protein (P01) now

Add to cart