DUSP22 monoclonal antibody (M01), clone 3D3 View larger

DUSP22 monoclonal antibody (M01), clone 3D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP22 monoclonal antibody (M01), clone 3D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,RNAi-Ab

More info about DUSP22 monoclonal antibody (M01), clone 3D3

Brand: Abnova
Reference: H00056940-M01
Product name: DUSP22 monoclonal antibody (M01), clone 3D3
Product description: Mouse monoclonal antibody raised against a partial recombinant DUSP22.
Clone: 3D3
Isotype: IgG2a Kappa
Gene id: 56940
Gene name: DUSP22
Gene alias: JKAP|JSP1|MKPX|VHX
Gene description: dual specificity phosphatase 22
Genbank accession: NM_020185
Immunogen: DUSP22 (NP_064570, 112 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Protein accession: NP_064570
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056940-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056940-M01-13-15-1.jpg
Application image note: Western Blot analysis of DUSP22 expression in transfected 293T cell line by DUSP22 monoclonal antibody (M01), clone 3D3.

Lane 1: DUSP22 transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr,RNAi-Ab
Related products: - MRPS22 monoclonal antibody (M10), clone 1E1
- C11orf30 monoclonal antibody (M01), clone 5D1
- XAB2 monoclonal antibody (M01), clone 1D1-1A9
- NT5M monoclonal antibody (M02), clone 3E2
- LHX9 monoclonal antibody (M01), clone 4C7
Shipping condition: Dry Ice
Publications: Promoter hypermethylation of the phosphatase DUSP22 mediates PKA-dependent TAU phosphorylation and CREB activation in Alzheimer's disease.Sanchez-Mut JV, Aso E, Heyn H, Matsuda T, Bock C, Ferrer I, Esteller M
Hippocampus. 2014 Jan 16. doi: 10.1002/hipo.22245.

Buy DUSP22 monoclonal antibody (M01), clone 3D3 now

Add to cart