Login to display prices
Login to display prices
DUSP22 monoclonal antibody (M01), clone 3D3 View larger

DUSP22 monoclonal antibody (M01), clone 3D3

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP22 monoclonal antibody (M01), clone 3D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,RNAi-Ab

More info about DUSP22 monoclonal antibody (M01), clone 3D3

Product description: Mouse monoclonal antibody raised against a partial recombinant DUSP22.
Clone: 3D3
Isotype: IgG2a Kappa
Gene id: 56940
Gene name: DUSP22
Gene alias: JKAP|JSP1|MKPX|VHX
Gene description: dual specificity phosphatase 22
Genbank accession: NM_020185
Immunogen: DUSP22 (NP_064570, 112 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Protein accession: NP_064570
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Size: 100 ug
Shipping condition: Dry Ice

30 other products in the same category: