Login to display prices
Login to display prices
DUSP22 MaxPab rabbit polyclonal antibody (D01) View larger

DUSP22 MaxPab rabbit polyclonal antibody (D01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP22 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsIF,WB-Tr,IP

More info about DUSP22 MaxPab rabbit polyclonal antibody (D01)

Product description: Rabbit polyclonal antibody raised against a full-length human DUSP22 protein.
Gene id: 56940
Gene name: DUSP22
Gene alias: JKAP|JSP1|MKPX|VHX
Gene description: dual specificity phosphatase 22
Genbank accession: NM_020185
Immunogen: DUSP22 (NP_064570.1, 1 a.a. ~ 184 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Protein accession: NP_064570.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Size: 100 uL
Shipping condition: Dry Ice

30 other products in the same category: