DUSP22 MaxPab rabbit polyclonal antibody (D01) View larger

DUSP22 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP22 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr,IP

More info about DUSP22 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00056940-D01
Product name: DUSP22 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human DUSP22 protein.
Gene id: 56940
Gene name: DUSP22
Gene alias: JKAP|JSP1|MKPX|VHX
Gene description: dual specificity phosphatase 22
Genbank accession: NM_020185
Immunogen: DUSP22 (NP_064570.1, 1 a.a. ~ 184 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Protein accession: NP_064570.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00056940-D01-31-15-1.jpg
Application image note: Immunoprecipitation of DUSP22 transfected lysate using anti-DUSP22 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DUSP22 purified MaxPab mouse polyclonal antibody (B01P) (H00056940-B01P).
Applications: IF,WB-Tr,IP
Related products: - DUSP22 purified MaxPab rabbit polyclonal antibody (D01P)
- C11orf30 polyclonal antibody (A01)
- C14orf124 MaxPab mouse polyclonal antibody (B01)
- C14orf124 purified MaxPab mouse polyclonal antibody (B01P)
- XAB2 polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy DUSP22 MaxPab rabbit polyclonal antibody (D01) now

Add to cart