DUSP22 MaxPab mouse polyclonal antibody (B01) View larger

DUSP22 MaxPab mouse polyclonal antibody (B01)

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP22 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about DUSP22 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00056940-B01
Product name: DUSP22 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DUSP22 protein.
Gene id: 56940
Gene name: DUSP22
Gene alias: JKAP|JSP1|MKPX|VHX
Gene description: dual specificity phosphatase 22
Genbank accession: NM_020185
Immunogen: DUSP22 (NP_064570.1, 1 a.a. ~ 184 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Protein accession: NP_064570.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056940-B01-13-15-1.jpg
Application image note: Western Blot analysis of DUSP22 expression in transfected 293T cell line (H00056940-T01) by DUSP22 MaxPab polyclonal antibody.

Lane 1: DUSP22 transfected lysate(20.24 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Related products: - DUSP22 purified MaxPab mouse polyclonal antibody (B01P)
- DUSP22 MaxPab rabbit polyclonal antibody (D01)
- DUSP22 purified MaxPab rabbit polyclonal antibody (D01P)
- C11orf30 polyclonal antibody (A01)
- C14orf124 MaxPab mouse polyclonal antibody (B01)
Shipping condition: Dry Ice

Buy DUSP22 MaxPab mouse polyclonal antibody (B01) now

Add to cart