Login to display prices
Login to display prices
DUSP22 polyclonal antibody (A01) View larger

DUSP22 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP22 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DUSP22 polyclonal antibody (A01)

Product description: Mouse polyclonal antibody raised against a partial recombinant DUSP22.
Gene id: 56940
Gene name: DUSP22
Gene alias: JKAP|JSP1|MKPX|VHX
Gene description: dual specificity phosphatase 22
Genbank accession: NM_020185
Immunogen: DUSP22 (NP_064570, 112 a.a. ~ 184 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Protein accession: NP_064570
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Size: 50 uL
Shipping condition: Dry Ice

30 other products in the same category: